if anyone could help, would be much appreciated

If Anyone Could Help, Would Be Much Appreciated

Answers

Answer 1

The numeric value of the expression is given as follows:

[f(x + h) - f(x)]/h = 5h + 10x + 6.

How to obtain the numeric value of a function or of an expression?

To obtain the numeric value of a function or of an expression, we substitute each instance of the variable in the function or in the expression by the value at which we want to find the numeric value.

The function for this problem is given as follows:

f(x) = 5x² - 6x + 1.

The numeric value at x = x + h is given as follows:

f(x + h) = 5(x + h)² - 6(x + h) + 1

f(x + h) = 5(x² + 2xh + h²) - 6x + 6h + 1

f(x + h) = 5x² + 10xh + 5h² - 6x + 6h + 1

Hence:

f(x + h) - f(x) = 5x² + 10xh + 5h² - 6x + 6h + 1 - 5x² + 6x + 1

f(x + h) - f(x) = 10xh + 5h² + 6h

f(x + h) - f(x) = h(5h + 10x + 6).

Simplifying by h, we have that:

[f(x + h) - f(x)]/h = 5h + 10x + 6.

Learn more about the numeric values of a function at brainly.com/question/28367050

#SPJ1


Related Questions

Decrease £14132.77 by 14.5%
Give your answer rounded to 2 Dp

Answers

Answer:

900

Step-by-step explanation:

because 14132.77/14.5%

Review Exercise
Acoin and a dice, labeled with letters A, B, C, D, E and F are tossed simultaneously. Find the
probability of getting a head and a vowel.

Answers

Answer:

Independent events and their probability

A circus has 15 performers, of which 5 are clowns. What is the probability that a randomly selected performer will be a clown?
Write your answer as a fraction or whole number

Answers

the probability of selecting a clown is 1/3, which is the answer to the problem.

The probability of an event happening is defined as the number of favorable outcomes divided by the total number of possible outcomes.

In this case, the total number of performers is 15, and the number of clowns is 5. Therefore, the probability of selecting a clown is:

P(clown) = number of clowns / total number of performers

= 5 / 15

= 1/3

Probability is a branch of mathematics that deals with the study of random events and their likelihood of occurrence. It is defined as the measure of the likelihood or chance of an event occurring.

The probability of an event is expressed as a number between 0 and 1, where 0 means that the event is impossible, and 1 means that the event is certain to happen. An event with a probability of 0.5 (or 50%) is considered to be equally likely to happen or not happen.

learn more about probability here:

https://brainly.com/question/12691315

#SPJ4

A fair de is rolled sx times. What is the probabiity that it comes up 4 at least once? Wrte your answer as a froction or a decimal, rounded to four decimal places.

Answers

0.4103

Answer:GivenA fair die is rolled six times.The probability that it comes up 4 at least once is to be determined.We have to find the probability that it comes up 4 atleast once which means that it can come up more than once as well.Therefore we have to consider all the cases i.e 1,2,3,4,5,6Case 1 : Number of times that it comes up 4 is 1The remaining number of times can be any of the remaining 5 numbersTherefore the probability of the event is(1/6) * (5/6)^5Case 2 : Number of times that it comes up 4 is 2The remaining number of times can be any of the remaining 5 numbersTherefore the probability of the event is(5C2 * (1/6)^2 * (5/6)^4)Case 3 : Number of times that it comes up 4 is 3The remaining number of times can be any of the remaining 5 numbersTherefore the probability of the event is(5C3 * (1/6)^3 * (5/6)^3)Case 4 : Number of times that it comes up 4 is 4The remaining number of times can be any of the remaining 5 numbersTherefore the probability of the event is(5C4 * (1/6)^4 * (5/6)^2)Case 5 : Number of times that it comes up 4 is 5The remaining number of times can be any of the remaining 5 numbersTherefore the probability of the event is(5C5 * (1/6)^5 * (5/6)^1)Now we will add all the cases to get the probability that it comes up 4 atleast once.P(A) = (1/6) * (5/6)^5 + (5C2 * (1/6)^2 * (5/6)^4) + (5C3 * (1/6)^3 * (5/6)^3) + (5C4 * (1/6)^4 * (5/6)^2) + (5C5 * (1/6)^5 * (5/6)^1)On solving we get P(A) = 0.4103Therefore the required probability is 0.4103 or 41.03% (approximately)Answer : 0.4103

Learn more about fair die

brainly.com/question/16644364

#SPJ4

Devonte is studying for a history test. He uses 1/8 of a side of one sheet of paper to write notes for each history event. He fills 2 full sides of one sheet of paper. Which expression could be used to find how many events Devonte makes notes for? Barry chose D as the correct answer. How did he get that answer?

Answers

Answer:

The total amount of space Devonte uses to write notes on a single sheet of paper is 2 sides x 1 sheet of paper = 2/1 = 2.

And, for each event, he uses 1/8 of a side of the paper. Therefore, the number of events he writes notes for can be found by dividing the total amount of space he used by the amount of space used for each event:

Number of events = Total space used / Space used per event

We can substitute the values we know:

Number of events = 2 / (1/8)

Simplifying this expression by multiplying the numerator and denominator by 8, we get:

Number of events = 2 x 8/1

Number of events = 16

Therefore, Devonte made notes for 16 historical events. Option D, 16, is the correct answer.

Step-by-step explanation:

Students in the high school choir sing one of four voice parts.

sopranos 5

altos 22

basses 8

tenors 5

What is the probability that a randomly selected singer will be a soprano?

Answers

The probability of selecting a soprano is 0.125 or 12.5%.

What distinguishes a probability from an odds ratio?

The percentage of times you anticipate seeing a certain occurrence across many trials is the chance that it will happen. Probabilities are always in the 0 to 1 range. The probability of an event happening divided by the likelihood that it won't happen is how odds are calculated.

Probability 0 is equivalent to chances 0. Odds less than 1.0 are represented by probabilities between 0 and 0.5. The chances of 1.0 are the same as a probability of 0.5. Consider it like this: 50% of the time, a coin will land on its head. The chances are "50:50," which translates to 1.0.

The total number of singers are:

5 + 22 + 8 + 5 = 40

Now, the probability of selecting a soprano is:

P(soprano) = 5 / 40

P(soprano) = 1/8 or 0.125

Therefore, the probability of selecting a soprano is 0.125 or 12.5%.

Learn more about probability here:

https://brainly.com/question/30884104

#SPJ1

Which sign makes the statement true?

Answers

Answer: <

It is "<" because 8 1/2 as a decimal is 8.50 and the other decimal is 8.375. 8.50 is greater than 8.375.

Your welcome!

=^..^=

Answer:<

Step-by-step explanation:

8.375= [tex]8\frac{375}{1000} =8\frac{3}{80} \\[/tex]

1/2=40/80

40/80>3/80

so,

could you please help me thank you and I think the values of X might be wrong thank you .
and I am sorry for a little bit of points it's because I don't have a lot I only have one hundred.​

Answers

The area of the triangle is  5√11 cm².

What are angles?

A point where two lines meet produces an angle.

The breadth of the "opening" between these two rays is referred to as a "angle". It is depicted by the figure.

Radians, a unit of circularity or rotation, and degrees are two common units used to describe angles.

By connecting two rays at their ends, one can make an angle in geometry. The sides or limbs of the angle are what are meant by these rays.

The limbs and the vertex are the two main parts of an angle.

The common terminal of the two beams is the shared vertex.

According to our question-

b = base of the triangle = 2(√6² - 5²) = 2(√36 - 25) = 2√11 cm

h = height of the triangle = 5 cm

area of the triangle = 1 / 2 × 2√11 × 5

area of the triangle = 5√11

area of the triangle =  5√11 cm²

Learn more on angles here click here:

brainly.com/question/2046046

#SPJ1

The equation of a line passing through points (-2,-4) and (4,4) is


PLEASE HELP

Answers

The equation of the line passing through (-2,-4) and (4,4) is y = (4/3)x - 4/3.

What is the equation of a line through a point that produces a slope?

The slope intercept formula, y = mx + b, is used when the slope of the line under study is known and the specified point is also the y intercept (0, b). In the equation, the term b stands in for the y value of the y intercept point.

Using the point-slope form of the equation, we can determine the equation of the line across two points:

y - y1 = m(x - x1)

where m is the slope of the line, and (x1, y1) is one of the provided locations.

Let's start by determining the line's slope:

m = (y2 - y1)/(x2 - x1)

where (x1, Y1) equals (-2, -4), and (x2, Y2) equals (4, 4)

m = (4 - (-4)) / (4 - (-2)) = 8 / 6 = 4 / 3

The equation of the line can now be determined using any of the supplied points:

Making use of (x1, y1) = (-2, -4)

y - (-4) = (4/3)(x - (-2))

y + 4 = (4/3)(x + 2)

y = (4/3)x + (8/3) - 4

y = (4/3)x - 4/3

Hence, y = (4/3)x - 4/3 is the equation for the line through (-2,-4) and (4,4).

To know more about Equation visit:

https://brainly.com/question/29538993

#SPJ1

A company produces two types of TV stands. Type 1 has 6 drawers. It requires 3 single drawer pulls and 3 double drawer pulls. The company needs 75 hours of labor to produce the Type 1 TV stand. Type 2 has 3 drawers. It requires 6 single drawer pulls. The company needs 50 hours of labor to produce the Type 2 TV stand. The company only has 600 labor hours available each week, and a total of 60 single-drawer pulls available in a week. For each Type 1 stand produced and sold, the company makes $200 in profit. For Type 2 stands produced and sold, the company earns $150 in profit.
A. Identify the constraints as a system of linear inequalities. Let x represent the number of 6-drawer TV stands produced and let y represent the number of 3-drawer TV stands produced.

Answers

The answer of the given question based on the linear equalities is the system of linear inequalities that represents the constraints is:

6x + 3y ≤ 600 , 3x + 6y ≤ 60 , x ≥ 0, y ≥ 0 .

What is Constraints?

constraints refer to a set of limitations or restrictions on the variables in a problem. These constraints can be in the form of equations or inequalities, and they define the feasible region of the problem.

The goal of solving a system of linear equations subject to constraints is to find a solution that satisfies all of the constraints while also solving the system of equations. The constraints limit the possible solutions to a subset of the full solution space, and finding a feasible solution that satisfies all of the constraints can be more challenging than finding a solution to the system of equations alone.

Let's first identify the variables in the problem:

x: number of Type 1 TV stands produced

y: number of Type 2 TV stands produced

Next, let's identify the constraints:

Labor constraint: the total labor hours used for producing the TV stands cannot exceed 600 hours.

6x + 3y ≤ 600

Single drawer pull constraint: the total number of single drawer pulls used for producing the TV stands cannot exceed 60 pulls.

3x + 6y ≤ 60

Non-negative constraint: the number of TV stands produced cannot be negative.

x ≥ 0, y ≥ 0

Therefore, the system of linear inequalities that represents the constraints is:

6x + 3y ≤ 600

3x + 6y ≤ 60

x ≥ 0, y ≥ 0

To know more about Variables visit:

https://brainly.com/question/2466865

#SPJ1

Where the objective function is: Profit = 200x + 150y.

What is inequalities?

In mathematics, an inequality is a mathematical statement that indicates that two expressions are not equal. It is a statement that compares two values, usually using one of the following symbols: "<" (less than), ">" (greater than), "≤" (less than or equal to), or "≥" (greater than or equal to).

Let x represent the number of Type 1 TV stands produced and y represent the number of Type 2 TV stands produced. Then, the constraints for the available labor and single drawer pulls can be represented as follows:

Labor constraint:

3x + 2y ≤ 600

Single-drawer pulls constraint:

3x + 6y ≤ 60

Non-negative constraint:

x, y ≥ 0

We also need to consider the practical constraint that we cannot produce a negative number of TV stands. Therefore, we must add the non-negative constraint as shown above.

Note that the coefficients 3, 2, 3, and 6 in the above inequalities are based on the information given in the problem statement.

Finally, to represent the objective function for maximizing profit, we use the following expression:

Profit = 200x + 150y

Thus, the system of linear inequalities that represents the given problem is:

3x + 2y ≤ 600

3x + 6y ≤ 60

x, y ≥ 0

Therefore, where the objective function is: Profit = 200x + 150y.

To learn more about inequalities from the given link:

https://brainly.com/question/30231190

#SPJ1

Jewellery Libby makes and sells jewellery. Libby is making a bracelet. She uses white beads and blue beads in the ratio 1:3 Libby uses 6 white beads for the bracelet. She has 10 blue beads. How many m

Answers

Libby requires an additional 8 blue beads to make a bracelet combing white beads and blue beads in a ratio of 1:3.

What is the ratio?

The ratio refers to the relative size of one value or quantity compared to another.

Ratios are expressed in percentages, fractions, or decimals and can also be expressed in the standard ratio forms (:) to show the comparative relationship one value bears to another.

The ratio of white beads to blue beads = 1:3

The sum of ratios = 4 (1 + 3)

The number of white beads = 6

The total number of beads = 24 (6 ÷ ¹/₄)

The number of blue beads required = 18 (24 - 6)

The number of blue beads Libby has = 10

The additional number of blue beads required = 8 (18 - 10)

Thus, based on the ratio of white beads to blue beads, Libby requires additional 8 blue beads to make a bracelet.

Learn more about ratios at https://brainly.com/question/2328454.

#SPJ1

Question Completion:

How many more blue beads does Libby require?

answer the question below

Answers

The time it takes to empty the tank is given as follows:

1.85 minutes.

How to obtain the volume of a cylinder?

The volume of a cylinder of radius r and height h is given by the equation presented as follows, which the square of the radius is multiplied by π and the height.

V = πr²h.

The parameters for this problem are given as follows:

r = 0.7 ft, as the radius is half the diameter.h = 3 ft.

Hence the volume of the cylinder in ft³ is given as follows:

V = π x 0.7² x 3

V = 4.62 ft³.

Oil is drained at a rate of 2.5 ft³ per minute, hence the time it takes to drain the oil is given as follows:

4.62/2.5 = 1.85 minutes.

More can be learned about the volume of a cylinder at brainly.com/question/9554871

#SPJ1

Express x^2 + 12x + 11 in the form (x+p)^2 + q

Answers

To convert a quadratic expression [tex]ax^2 + bx + c[/tex] to the form [tex](x+p)^2 + q[/tex], where p=b/2a and [tex]q=(b^2-4ac)/4a[/tex], complete the square by adding and subtracting [tex](b/2)^2[/tex] and simplify the resulting expression.

To express the quadratic expression [tex]x^2 + 12x + 11[/tex] in the form [tex](x+p)^2 + q[/tex], we need to complete the square by adding and subtracting a suitable constant term.

First, we take half of the coefficient of x (which is 12) and square it, giving [tex](12/2)^2 = 36[/tex]. We then add and subtract this value inside the bracket:

[tex]x^2 + 12x + 11 = x^2 + 12x + 36 - 36 + 11[/tex]

Now we can group the first three terms and write them as a square of a binomial:

[tex]x^2 + 12x + 36 = (x + 6)^2[/tex]

Simplifying the remaining terms, we have:

[tex]x^2 + 12x + 11 = (x + 6)^2 - 25[/tex]

Therefore, we have expressed the quadratic expression [tex]x^2 + 12x + 11[/tex] in the form [tex](x+p)^2 + q[/tex], where p = 6 and q = -25.

In general, to express a quadratic expression of the form [tex]ax^2 + bx + c[/tex] in the form [tex](x+p)^2 + q[/tex], where a, b, and c are constants and p and q are to be determined, we can follow these steps:

Take half of the coefficient of x (which is b/2) and square it, giving [tex](b/2)^2[/tex].

Calculate this value inside the bracket:

[tex]ax^2 + bx + c = ax^2 + bx + (b/2)^2 - (b/2)^2 + c[/tex]

Group the first three terms and write them as a square of a binomial:

[tex]ax^2 + bx + (b/2)^2 = a(x + b/2a)^2[/tex]

Simplify the remaining terms:

[tex]ax^2 + bx + (b/2)^2 + c - (b/2)^2 = a(x + b/2a)^2 + (4ac-b^2)/4a[/tex]

We can simplify the expression (4ac-b^2)/4a by recognizing that it is the discriminant of the quadratic equation [tex]ax^2 + bx + c = 0[/tex], which is [tex]b^2 - 4ac[/tex]. Therefore, we have:

[tex]ax^2 + bx + c = a(x + b/2a)^2 + (b^2 - 4ac)/4a[/tex]

We can rewrite this in the form [tex](x+p)^2 + q[/tex] by identifying p and q:

p = b/2a, and [tex]q = (b^2 - 4ac)/4a[/tex].

Therefore, the quadratic expression [tex]ax^2 + bx + c[/tex] can be expressed in the form [tex](x+p)^2 + q[/tex], where p = b/2a and [tex]q = (b^2 - 4ac)/4a[/tex].

Learn more about quadratic expression here:

https://brainly.com/question/14083225

#SPJ4

Suppose that, for a certain mathematics class, the scores are normally distributed with a mean of 75 and a standard deviation of 8. The teacher wishes to give A's to the top 5% of the students and F's to the bottom 5%. The next 15% in either direction will be given B's and D's, with the other students receiving C's. Find the bottom cutoff for receiving an A grade.

Answers

The bottom cutoff for receiving an A grade is 88.16.

What is the statistical application of the empirical rule?

A statistical concept known as the empirical rule, often called the 68-95-99.7 rule, asserts that for a normal distribution: Around 68% of the data falls within one standard deviation of the mean.

The data is within two standard deviations of the mean for around 95% of the time. The data is within three standard deviations of the mean for about 99.7% of the time.

To find the bottom cutoff we need to find 5% of the students that score higher.

Using the z-score for 5% distribution we have:

z = 1.645

Formula for converting a z-score to a raw score:

z = (x - μ) / σ

x = z * σ + μ

x = 1.645 * 8 + 75

x = 88.16

Hence, the bottom cutoff for receiving an A grade is 88.16.

Learn more about z-score here:

https://brainly.com/question/30557336

#SPJ9

Carmen buys candy that costs 7 $ per pound. She will spend more than 56$ on candy. What are the possible numbers of pounds she will buy?
Use p for the number of pounds Carmen will buy.
Write your answer as an inequality solved for p.

write as an Inequality

Answers

We can say that after answering the offered question Hence, p > 8 is the equation inequality expressing the range of feasible values for p.

What is equation?

An equation is a mathematical statement that proves the equality of two expressions connected by an equal sign '='. For instance, 2x – 5 = 13. Expressions include 2x-5 and 13. '=' is the character that links the two expressions. A mathematical formula that has two algebraic expressions on either side of an equal sign (=) is known as an equation. It depicts the equivalency relationship between the left and right formulas. L.H.S. = R.H.S. (left side = right side) in any formula.

Let's use the letter "p" to indicate how many pounds Carmen will spend.

Candy is $7 for every pound.

Carmen's sweets expenditure is expressed as follows:

Cost per pound times the weight of the candy purchased is 7p.

Carmen will undoubtedly spend more than $56 on sweets, therefore we may say:

More than $56 was spent on candy

Using the following equation in place of the amount spent on candy:

7p > $56

When we multiply both sides by 7, we get:

p > 8

So, any figure more than 8 is a possibility for the amount of pounds Carmen will purchase. We can express this as follows:

p > 8

Hence, p > 8 is the inequality expressing the range of feasible values for p.

To know more about equation visit:

https://brainly.com/question/649785

#SPJ1

7. Josh is going to draw a net of a rectangular
prism. How many rectangles should there
be in his drawing?

Answers

The number of rectangles in Josh's drawing should be 6.

What is rectangular prism?

A three-dimensional solid shape that has six rectangular faces is a rectangular prism. It has eight vertices, or corners, and 12 edges connecting the vertices.

To draw a net of a rectangular prism, Josh needs to represent the three-dimensional object on a two-dimensional surface by drawing each face of the prism separately. A rectangular prism has six faces, and every face is a rectangle.

Josh needs to draw all six rectangles that make up the six faces of the prism. The six faces consist of a pair of congruent rectangles for the top and bottom faces, and four rectangles for the sides. Josh can arrange the six rectangles in different ways to create a net that will fold into a rectangular prism.

It is important that Josh draws the rectangles accurately and with correct dimensions to ensure that the net can be assembled into a rectangular prism.

To know more about three-dimensional solid visit:

https://brainly.com/question/17121977

#SPJ9

Please help! If you could please also explain so I understand how it is done. Thank you :)

Answers

Mr. Paquette has 2 pencils and 6 pens after simplification.

What is a Equation?

An equation is a mathematical statement that asserts that two expressions are equal. It is a representation of a relationship between two or more variables, which can be solved to find the values of those variables that satisfy the equation. An equation typically consists of two sides separated by an equal sign (=), with expressions containing variables and constants on each side.

What is simplification?

Simplification refers to the process of making something simpler or easier to understand. It involves breaking down complex or complicated information into smaller, more manageable parts, and eliminating unnecessary or redundant details.

Let's assume that Mr. Paquette has x pencils. Since he has a combined total of 8 pencils and pens, he must have (8 - x) pens.

We know that for each pencil he has, he has 3 pens. Therefore, the total number of pens he has is 3 times the number of pencils:

Total number of pens = 3x

We also know that the total number of pencils and pens is 8. Therefore, we can write an equation:

x + 3x = 8

Simplifying and solving for x, we get:

4x = 8

x = 2

So Mr. Paquette has 2 pencils and 6 pens (since he has 3 pens for each pencil).

To know more about Equations, visit:

https://brainly.com/question/30245138

#SPJ1

The whiteboard is 4.5 feet in width.
1. How many inches wide is the whiteboard?

Answers

Answer: The board is 54 inches wide

The width of a whiteboard, in inches, is 54.

What is multiplication?

Multiplication is a type of mathematical operation. The repetition of the same expression types is another aspect of the practice.

For instance, the expression 2 x 3 indicates that 3 has been multiplied by two.

We know that the width of the whiteboard is 4.5 feet.

However, if we need to express this width in inches, we have to convert feet to inches, as the two units are not directly comparable.

There are 12 inches in a foot.

Therefore, to convert a value in feet to inches, we can simply multiply the value by 12. In other words, 1 foot is equal to 12 inches.

So, to convert the width of the whiteboard from feet to inches, we can simply multiply the width (4.5 feet) by the conversion factor of 12 inches/foot as follows:

4.5 feet × 12 inches/foot = 54 inches

Therefore, the whiteboard is 54 inches wide.

To learn more about multiplication;

https://brainly.com/question/19634536

#SPJ2

Find the value of the indicated trigonometric ratio.

Answers

Tan has a value of 3/4. Trigonometric theory has been used to arrive at this value.

Is trigonometry challenging?

This is due to the fact that trigonometry is still regarded as a relatively challenging and abstract branch of mathematics in comparison to other branches. When learning trigonometry, students frequently run across mistakes, misunderstandings, and barriers.

What is the most difficult math?

Calculus is the most difficult math topic, and very few students, whether in junior high or elsewhere, succeed in it. In vector space, linear algebra is a subset of abstract algebra. Matrix technology makes things less abstract & easier to understand because it is more concrete.

tan α [tex]= \frac{15}{20}[/tex]

⇒tan α [tex]=\frac{3}{4}[/tex]

To know more about trigonometry visit:

https://brainly.com/question/26719838

#SPJ1

Example
Determine the zeros of f(x) = (2x-1)(-x+3)(3x-4), and graph the function.
The zeros of the function represent the values of x that make the function equal to zero. Replace the function notation with 0 to determine the zeros of
the function.
f(x)=(2x-1)(-x+3)(3x-4)
0=(2x-1)(-x+3)(3x-4)
(2x-1)=0
2x = 1
1
x=2
14
The zeros for the function f(x) are x = 23
(-x+3)=0
-x=-3
x=3
(3x-4)=0
3x=4
4
x=
10
3
3. Using multiplication, f(x) = (2x-1)(-x+3)(3x-4)=-6x³+29x²-37x+12
The function has an odd degree, so the ends will travel in opposite directions. The leading coefficient is negative, so the left side continues up and the
right side continues down.

Answers

The graph has x-intercepts at 1/2, 3, and 4/3, a y-intercept at (0, 12), and is symmetric about x = 1.833. The left end goes up, and the right end goes down.

What is the function?

A function is a relation between a set of inputs (called the domain) and a set of possible outputs (called the range) such that each input is associated with exactly one output. In other words, a function takes an input value, performs a specific operation on it, and produces a unique output value.

To graph the function, we can start by finding its intercepts, symmetry, and behavior at infinity.

The x-intercepts occur when the function is equal to zero, so we have already found them to be 1/2, 3, and 4/3.

The y-intercept occurs when x is zero, so we have:

f(0) = (2(0)-1)(-0+3)(3(0)-4) = 12

So the y-intercept is (0, 12).

To find the axis of symmetry, we can use the fact that the function is symmetric about the vertical line x = (1/2 + 3 + 4/3) / 3 = 1.833.

To determine the end behavior, we can look at the leading term of the function, which is -6x³. As x goes to negative infinity, the leading term becomes very negative, so the graph goes down to negative infinity on the left side. As x goes to positive infinity, the leading term becomes very positive, so the graph goes up to positive infinity on the right side.

The graph has x-intercepts at 1/2, 3, and 4/3, a y-intercept at (0, 12), and is symmetric about x = 1.833. The left end goes up, and the right end goes down.

To know more about graph, visit:

brainly.com/question/11803331

#SPJ9

Inga is solving 2x2 + 12x – 3 = 0. Which steps could she use to solve the quadratic equation? Select three options. 2(x2 + 6x + 9) = 3 + 18 2(x2 + 6x) = –3 2(x2 + 6x) = 3 x + 3 = Plus or minus StartRoot StartFraction 21 Over 2 EndFraction EndRoot 2(x2 + 6x + 9) = –3 + 9

Answers

The steps he can use in solving the quadratic equations are [tex]x = \frac{-12 \± \sqrt{12\² - 4 \cdot 2 \cdot -3}}{4}[/tex], (x + 3)² = 21/2 and 2(x² + 6x + 9) = 3 + 18

How to determine the steps he can use

The equation is given as

2x² + 12x - 3 = 0

Assuming he uses the quadratic formula method, which is represented as

[tex]x = \frac{-b \± \sqrt{b\² - 4ac}}{2a}[/tex]

So, we have

[tex]x = \frac{-12 \± \sqrt{12\² - 4 \cdot 2 \cdot -3}}{2 \cdot 2}[/tex]

[tex]x = \frac{-12 \± \sqrt{12\² - 4 \cdot 2 \cdot -3}}{4}[/tex]

If he uses completing the square, then we have

2x² + 12x = 3

So, we have

x² + 6x = 3/2

x² + 6x + 9 = 3/2 + 9

So, we have

(x + 3)² = 21/2

If he factorizes, then the expression is

2(x² + 6x + 9) = 3 + 18

Read more about quadratic function at

https://brainly.com/question/25841119

#SPJ1

Identify the following: · Statistic · Significance Level · Test Statistic · P-value And then complete the 4 step process to assess this claim: In a random sample of 300 patients, 21 experience nausea. A drug manufacturer claims that fewer than 10% of patients who take its new drug for treating Alzheimer’s’ disease will experience nausea. Test this claim with α= 0.05.

Answers

10%.

Identified are:StatisticSignificance LevelTest StatisticP-valueStep 1: State the null and alternative hypothesis for the claimThe null hypothesis H0: P≥0.1 (or P=0.1)The alternative hypothesis H1: P<0.1Step 2: Determine the significance levelα= 0.05Step 3: Compute the test statistic, P-value, and critical value.Test statistic is given as z= (x- μ) / (σ/√n)Where x= 21 (number of patients who experienced nausea)μ= nP = 0.1(300)= 30σ= √(n*P*(1-P)) = √(300*0.1*0.9) = 4.74z= (21-30)/(4.74/√300)= -5.87P-value= P(z<-5.87)≈0Critical value= zα= z0.05= -1.64Step 4: Make a decisionReject H0 if z≤zα else do not reject H0z= -5.87 < zα= -1.64Hence, reject the null hypothesis, which means there is evidence that the proportion of patients who experience nausea from taking the drug is less than 10%.

Learn more about nausea

brainly.com/question/8171653

#SPJ4

Caitlyn sells xylophones and yo-yos at the county fair. She wants to sell more than 30 toys. She sells the

xylophones for $3. 00 and the yo-yos for $0. 50. She needs to sell more than $40. 00 worth of toys in order to

earn a profit.

a) Write a system of inequalities (where is the number of xylophones and y is the number of yo-yos).

Answers

Answer:

x + y > 30

3x + 0.5y > 40.00

Step-by-step explanation:

Let x be the number of xylophones and y be the number of yo-yos sold.

The total number of toys sold must be greater than 30, so we have:

x + y > 30

The total amount earned must be greater than $40.00 to earn a profit, so we have:

3x + 0.5y > 40.00

Therefore, the system of inequalities is:

x + y > 30

3x + 0.5y > 40.00

Find the range of the data set: 10, 18, 21, 28, 12, 20. A. 10 B. 12 C. 18 D. 20

Answers

Answer:

18

Step-by-step explanation:

The range of the data set is 18, which is calculated by subtracting the smallest value (10) from the largest value (28).

HELP ASAP A certain breand of nuts costs $3.20 for 16 ounces what is the unit rate

Answers

The unit rate is the cost of the certain brand of nuts per ounce, which is $0.20. This is the same as 20 cents per ounce.

What is the Unit Rate?

The unit rate is a measure of a quantity, such as the cost of a product, in relation to a single unit of that quantity. In this case, the cost of the nuts is measured in dollars and the quantity is measured in ounces.

To find the unit rate, we need to divide the total cost by the total quantity. In this problem, the total cost of the nuts is given as $3.20 and the total quantity is given as 16 ounces. Dividing these two numbers, we get:

Unit rate = Total cost / Total quantity

= $3.20 / 16 ounces

= $0.20 per ounce

Learn more about the unit rate on:

https://brainly.com/question/19493296

#SPJ1

3 A cake is made of three round layers. The diameters and heights are in the ratio 5:3:2 The cake's bottom layer has a diameter of 30cm and a height of 10cm. Work out the following, giving your answers to the nearest whole number. cm (1 mark ) a

Answers

The diameter of the middle layer is 18 cm and the height is 9 cm. The diameter of the top layer is 12 cm and the height is 5 cm.

The ratios of the diameters and the heights are 5:3:2. Therefore, to calculate the diameters and heights of the other two layers, we need to take the bottom layer's diameter and height as our reference values.

The diameter of the bottom layer is 30 cm and the height is 10 cm.

To find the diameter and height of the middle layer, we multiply the bottom layer's values by 3/5 and then 3/2 respectively. So, the diameter of the middle layer is (30 x 3/5) cm = 18 cm and the height is (10 x 3/2) cm = 9 cm.

To find the diameter and height of the top layer, we multiply the bottom layer's values by 2/5 and then 1/2 respectively. So, the diameter of the top layer is (30 x 2/5) cm = 12 cm and the height is (10 x 1/2) cm = 5 cm.

Learn more about diameter here

https://brainly.com/question/30460318

#SPJ1

QUESTION 26 Joanne has $4408 in an account earning 3.7% simple interest per annum. Calculate the amount of simple interest after 17 months

Answers

The amount of simple interest after 17 months is $72.21.

To calculate the amount of simple interest after 17 months, given that Joanne has $4408 in an account earning 3.7% simple interest per annum, the following steps are involved:

Calculation of simple interest

Simple interest can be calculated using the formula;

Simple interest = P × R × T

where, P = principal amount, R = rate of interest, and T = time in years.To calculate the amount of simple interest for Joanne, we have;

P = $4408R = 3.7% per annum

T = 17 months ÷ 12 months/year

T = 1.4167 years

Substituting the values into the formula for simple interest;

Simple interest = P × R × T= $4408 × 3.7% × 1.4167= $72.21.

You can learn more about interest at: brainly.com/question/30393144

#SPJ11

can you guys help with this math problem

Answers

Answer:

D. 9/4

Step-by-step explanation:

Answer: D

Step-by-step explanation:

-1 1/4 + -3 2/4

Cross out the negative sign because we're working with negatives in this equation. Due to taking away the negative sign, we would subtract.

3 2/4 - 1 1/4 = 9/4

Have a good day :D

Make 'h' the subject of the following equation:

k = 3h - 1

Answers

The mathematical expression that would make "h" the subject of the equation is h= k-1/3

What is an equation?

To begin an equation is a mathematical expression that relates variables by using the = symbol. Due to this, the letters of variables involved can be changed to create equivalent equations.

How to make the variable h the subject of the equation?

The equation given is written is k= 3h - 1. To make h the subject of formula 3h= k - 1 Divide both sides by the coefficient of h which in this case is 33h/3= k-1/3h= k - 1/3.

Hence the value of h in the equation is k - 1/3

Read more on equation here https://brainly.com/question/16830194

#SPJ1

When r is not significantly different from 0, the best predictor of y is the ________ of the data values of y

Answers

The best predictor of y when r is not significantly different from 0 is the mean of the data values of y, which can be calculated using the formula (∑y)/n.

The best predictor of y when r is not significantly different from 0 is the mean of the data values of y. This can be calculated using the formula:

mean = (∑y)/n

Where ∑y is the sum of all the y values in the data set and n is the number of y values in the data set.

For example, if the data set is comprised of five y values of -2, -1, 0, 1, and 2, we would have ∑y = -2 + -1 + 0 + 1 + 2 = 0. The number of y values, n, is 5. Therefore, the mean of the data would be 0/5 = 0.

The mean of the data is a useful predictor of y when r is not significantly different from 0 because it is an average of all the values in the data set. This means that it takes into account all the data points and can give a reliable prediction of what the value of y is likely to be. Since r is not significantly different from 0, this means that there is no strong relationship between the two variables, and so the mean of the data can be used to provide an accurate prediction of y.

Learn more about mean here:

https://brainly.com/question/3660216

#SPJ4

Other Questions
infer the consequence for evolution if speices did not vary (1 point) Assume that the monthly wondwide average number of airplaine crashes of commercial ailines is \( 2.2 \). What is the probability that there wili be (a) at most 3 such accidents in the next m Carlos is creating a 3D newspaper. He wants the text to be readable, but currently the lines are so close together that the bottoms of some letters (like y and p) touch the tops of some capital letters on the following line. What should he adjust to fix this problem?Question 11 options:formattingtrackingtypefacingleading ............................. 1. There are three buses A, B and C. the totalnumber of seats in the three buses is 250. 28% ofthe 250 seat are in bus A.number of seats in bus B:number of seats in busC = 3:238 of the seats in bus B are empty. 26 in bus Care empty.Jamie says the percentage of the seats in bus Bthat are empty is greater than the percentage ofthe seats in bus C that are empty. Is Jamiecorrect. Evaluate the traits of the ancient hero Odysseus. How do these traits influence our modern view of a hero? In an essay, appraise Odysseus's character traits and relate these to the character traits of the modern hero. What traits remain and what traits have changed? Why? PLEASE SHOW WORK!!!!!!!!! A rectangular bathroom tile is 2 and 1/3 times as wide as it is tall . If the tile is 5 cm tall,how wide is isA 3 and 2/3 cmB 7 and 1/3 cm C 10 and 1/3 cm Help me find the answer pls What is the measure of angle H? Explain what is the measure of angle i ? explain What is the molarity of a KCl solution if there are 59.0 grams of KCl dissolved in water to make 2.0 liters of solution? What is relationship between inflation and interest rates? Why must the negative terminals of the batteries be connected on the same side of the parallel circuit and positive terminals on the other side Hull Company reported the following income statement information for the current year:Sales$413,000Cost of goods sold:Beginning inventory$136,500Cost of goods purchased276,000Cost of goods available for sale412,500Ending inventory147,000Cost of goods sold265,500Gross profit$147,500The beginning inventory balance is correct. However, the ending inventory figure was overstated by $23,000.Given this information, calculate gross profit.Cost of Goods SoldCost of Goods Sold or shortly known as CoGS is a term used to refer to the total amount of goods sold to the customers, the amount of which is expressed at their original purchase price for a retail business. a company just paid total dividends of $750,000 and reported additions to retained earnings of $2,250,000. the company has 585,000 shares of stock outstanding and a benchmark p/e ratio of 16 times. what stock price would you consider appropriate? Divide 12a7b2 by 4a2b. 3a5b2 3a5b3 3a5b 3a9b3 who is the group who needs to be a big part of developing a strong program for handling disruptive behavior Is -3 a real irrational rational integer or a whole number Need the steps1. Add a "Total Revenue" column by multiplying the "Billable Hours" column by the "Hourly Rate" column for each year.2. Add a "Total Billable Hours" column by summing up the "Billable Hours" column for each year.3. Add an "Average Hourly Rate" column by dividing the "Total Revenue" column by the "Total Billable Hours" column for each year.4. Sort the table by the "Hourly Rate" column in descending order. Which name is a correct way to name the tiling? Which deal is better. 500ml of lemonade for 94p or 750ml of lemonade for 1.44